Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP4 Rabbit pAb (APR18907N)

Product Specifications

Background

The protein encoded by this gene is a protease that deubiquitinates target proteins such as ADORA2A and TRIM21. The encoded protein shuttles between the nucleus and cytoplasm and is involved in maintaining operational fidelity in the endoplasmic reticulum. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USP4 Rabbit pAb (APR18907N) .

Synonyms

USP4; UNP; Unph

Gene ID

7375

UniProt

Q13107

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/103kDa/108kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7375

Uniprot URL

https://www.uniprot.org/uniprot/Q13107

AA Sequence

DDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mug98 Antibody
orb855160 2 mg

Mug98 Antibody

Sign In for Pricing
View Details
ARL15 Antibody
24932 100 µL

ARL15 Antibody

Sign In for Pricing
View Details
H2AC25 Knockout Hela Polyclonal Cells
ARG37618 1 Million

H2AC25 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
ZNF579 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2418793 100 µL

ZNF579 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Monkey CER ELISA Kit
EMKC0097 96 Tests

Monkey CER ELISA Kit

Sign In for Pricing
View Details
Beta 2 Microglobulin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61163R-BF647-01 20 µL

Beta 2 Microglobulin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details