Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRBP1 Rabbit pAb (APR18903N)

Product Specifications

Background

This gene encodes a ribosome-binding protein of the endoplasmic reticulum (ER) membrane. Studies suggest that this gene plays a role in ER proliferation, secretory pathways and secretory cell differentiation, and mediation of ER-microtubule interactions. Alternative splicing has been observed and protein isoforms are characterized by regions of N-terminal decapeptide and C-terminal heptad repeats. Splicing of the tandem repeats results in variations in ribosome-binding affinity and secretory function. The full-length nature of variants which differ in repeat length has not been determined. Pseudogenes of this gene have been identified on chromosomes 3 and 7, and RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome, the result of a mutation in a nearby gene on chromosome 20p12.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RRBP1 Rabbit pAb (APR18898N9) .

Synonyms

RRBP1; ES/130; ES130; RRp; hES

Gene ID

6238

UniProt

Q9P2E9

Cellular Locus

Endoplasmic reticulum membrane, Single-pass type III membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 108kDa/152kDa Observed MW: 120kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6238

Uniprot URL

https://www.uniprot.org/uniprot/Q9P2E9

AA Sequence

MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAPVATVPAMPQEKLASSPKDKK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (MaxLight 750)
MBS6233277-01 0.1 mL

HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (MaxLight 750)

Ask
View Details
HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (MaxLight 750)
MBS6233277-02 5x 0.1 mL

HOOK3 (Protein Hook Homolog 3, h-hook3, hHK3, FLJ31058) (MaxLight 750)

Ask
View Details
Human FAM43A knockout cell line
ABC-KH5249 1 Vial

Human FAM43A knockout cell line

Ask
View Details
Lentiviral mouse Fam181b shRNA (UAS) - Lentiviral mouse Fam181b shRNA (UAS, iRFP) (100)
GTR15268323 1 Vial

Lentiviral mouse Fam181b shRNA (UAS) - Lentiviral mouse Fam181b shRNA (UAS, iRFP) (100)

Ask
View Details
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 216R (IIV6-216R)
MBS1429253-01 0.02 mg (E-Coli)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 216R (IIV6-216R)

Ask
View Details
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 216R (IIV6-216R)
MBS1429253-02 0.1 mg (E-Coli)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 216R (IIV6-216R)

Ask
View Details