Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE8A Rabbit pAb (APR18861N)

Product Specifications

Background

The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE8 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PDE8A Rabbit pAb (APR18861N) .

Synonyms

PDE8A; HsT19550

Gene ID

5151

UniProt

O60658

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/29kDa/86kDa/88kDa/93kDa Observed MW: 93kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5151

Uniprot URL

https://www.uniprot.org/uniprot/O60658

AA Sequence

MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (ALPI) (NM_001631) Human Recombinant Protein
TP324178L 1 mg

Alkaline Phosphatase (ALPI) (NM_001631) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Hepatitis B Virus (HBV) (ayw/France/Tiollais/1979) Capsid protein (His Tag)
PKSV030175 100 µg

Recombinant Hepatitis B Virus (HBV) (ayw/France/Tiollais/1979) Capsid protein (His Tag)

Sign In for Pricing
View Details
GALE (NM_000403) Human Over-expression Lysate
LY424739 100 µg

GALE (NM_000403) Human Over-expression Lysate

Sign In for Pricing
View Details
Monic Acid A
TRC-M520500-50MG 50 mg

Monic Acid A

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2908R), CF640R conjugate, 0.1mg/mL
BNC402908-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2908R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF594 conjugate, 0.1mg/mL
BNC940264-100 1x 100 µL

Human Kappa Light Chain (KLC264), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details