Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK1 Rabbit pAb (APR18858N)

Product Specifications

Background

This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AK1 Rabbit pAb (APR18858N) .

Synonyms

AK1; HTL-S-58j

Gene ID

203

UniProt

P00568

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 22kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=203

Uniprot URL

https://www.uniprot.org/uniprot/P00568

AA Sequence

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycerol Molecular Biology
01293 00500 500 mL

Glycerol Molecular Biology

Sign In for Pricing
View Details
TC-PTP siRNA (h)
sc-76635 10 µM

TC-PTP siRNA (h)

Sign In for Pricing
View Details
Hsa-miR-8053 miRNA Agomir
orb1919030-01 5 nmol

Hsa-miR-8053 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-8053 miRNA Agomir
orb1919030-02 10 nmol

Hsa-miR-8053 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-8053 miRNA Agomir
orb1919030-03 20 nmol

Hsa-miR-8053 miRNA Agomir

Sign In for Pricing
View Details
Recombinant Feline panleukopenia virus Non-capsid protein NS-1 (NS1), partial
MBS1148001 Inquire

Recombinant Feline panleukopenia virus Non-capsid protein NS-1 (NS1), partial

Sign In for Pricing
View Details