Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGTRAP Rabbit pAb (APR18856N)

Product Specifications

Background

This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AGTRAP Rabbit pAb (APR18856N) .

Synonyms

AGTRAP; ATRAP

Gene ID

57085

UniProt

Q6RW13

Cellular Locus

Cytoplasmic vesicle membrane, Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa/16kDa/17kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57085

Uniprot URL

https://www.uniprot.org/uniprot/Q6RW13

AA Sequence

ILSLLLKPLSCCFVYHMYRERGGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spam1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3401103 1.0 µg DNA

Spam1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-93138-01 60 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-93138-02 120 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-93138-03 200 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
HSD3B2 (HSDB3B, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 2, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type II, 3-beta-HSD Adrenal and Gonadal Type, 3-beta-hydroxy-Delta (5) -steroid Dehydrogenase, 3-beta-hydroxy-5-ene Steroid Dehydrogenase, Progesterone Reductase, Steroid Delta-isomerase, Delta-5-3-ketosteroid Isomerase) (PE)
128106-PE 100 µL

HSD3B2 (HSDB3B, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 2, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type II, 3-beta-HSD Adrenal and Gonadal Type, 3-beta-hydroxy-Delta (5) -steroid Dehydrogenase, 3-beta-hydroxy-5-ene Steroid Dehydrogenase, Progesterone Reductase, Steroid Delta-isomerase, Delta-5-3-ketosteroid Isomerase) (PE)

Sign In for Pricing
View Details
Mouse Insulin-like growth factor binding protein 3, IGFBP-3 ELISA KIT
orb1670903 96 Tests

Mouse Insulin-like growth factor binding protein 3, IGFBP-3 ELISA KIT

Sign In for Pricing
View Details