Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1G Rabbit pAb (APR18851N)

Product Specifications

Background

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PPM1G Rabbit pAb (APR18851N) .

Synonyms

PPM1G; PP2CG; PP2CGAMMA; PPP2CG

Gene ID

5496

UniProt

O15355

Cellular Locus

Cytoplasm, Lipid-anchor, Membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 59kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5496

Uniprot URL

https://www.uniprot.org/uniprot/O15355

AA Sequence

DTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS706163 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human HAUS augmin-like complex subunit 5, HAUS5 ELISA KIT
ELI-48617h 96 Tests

Human HAUS augmin-like complex subunit 5, HAUS5 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human RRP1B shRNA (UAS) - Lentiviral human RRP1B shRNA (UAS, RFP) plasmid
GTR15153409 1 Vial

Lentiviral human RRP1B shRNA (UAS) - Lentiviral human RRP1B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Lentiviral human RBMS1 sgRNA gene knockout kit - Lentiviral human RBMS1 sgRNA gene knockout kit (100)
GTR15382087 1 Vial

Lentiviral human RBMS1 sgRNA gene knockout kit - Lentiviral human RBMS1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Sheep Defensin Beta 4 (DEFB4) ELISA Kit
MBS9360878-01 48 Well

Sheep Defensin Beta 4 (DEFB4) ELISA Kit

Sign In for Pricing
View Details
Sheep Defensin Beta 4 (DEFB4) ELISA Kit
MBS9360878-02 96 Well

Sheep Defensin Beta 4 (DEFB4) ELISA Kit

Sign In for Pricing
View Details