Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMEPA1 Rabbit pAb (APR18849N)

Product Specifications

Background

This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM) . Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PMEPA1 Rabbit pAb (APR18847N1) .

Synonyms

PMEPA1; STAG1; TMEPAI

Gene ID

56937

UniProt

Q969W9

Cellular Locus

Early endosome membrane, Golgi apparatus membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/27kDa/31kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56937

Uniprot URL

https://www.uniprot.org/uniprot/Q969W9

AA Sequence

PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) rps1802 Polyclonal Antibody
MBS7143387 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) rps1802 Polyclonal Antibody

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) CLIA Kit
abx493790-01 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) CLIA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) CLIA Kit
abx493790-02 5x 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) CLIA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) CLIA Kit
abx493790-03 10x 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) CLIA Kit

Sign In for Pricing
View Details
ZFP57 (NM_001109809) Human Untagged Clone
SC327908 10 µg

ZFP57 (NM_001109809) Human Untagged Clone

Sign In for Pricing
View Details
GSK-3 Inhibitor XIII
451487 1 mg

GSK-3 Inhibitor XIII

Sign In for Pricing
View Details