Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2 Rabbit pAb (APR18834N)

Product Specifications

Background

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) . The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LILRB2 Rabbit pAb (APR18834N) .

Synonyms

LILRB2; CD85D; ILT-4; ILT4; LIR-2; LIR2; MIR-10; MIR10

Gene ID

10288

UniProt

Q8N423

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/55kDa/64kDa/65kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10288

Uniprot URL

https://www.uniprot.org/uniprot/Q8N423

AA Sequence

LFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFER Antibody
CSB-PA009370ESR2HU-01 50 μL

GFER Antibody

Sign In for Pricing
View Details
GFER Antibody
CSB-PA009370ESR2HU-02 100 µL

GFER Antibody

Sign In for Pricing
View Details
Olr1202 AAV Vector (Rat) (CMV)
33742106 1 µg

Olr1202 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
IP6K2 Rabbit pAb (APR20018N)
APR20018N-01 50 µL

IP6K2 Rabbit pAb (APR20018N)

Sign In for Pricing
View Details
IP6K2 Rabbit pAb (APR20018N)
APR20018N-02 100 µL

IP6K2 Rabbit pAb (APR20018N)

Sign In for Pricing
View Details
IP6K2 Rabbit pAb (APR20018N)
APR20018N-03 200 µL

IP6K2 Rabbit pAb (APR20018N)

Sign In for Pricing
View Details