Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EP400 Rabbit pAb (APR18830N)

Product Specifications

Background

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. May be required for transcriptional activation of E2F1 and MYC target genes during cellular proliferation. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. May regulate ZNF42 transcription activity. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EP400 Rabbit pAb (APR18830N) .

Synonyms

EP400; CAGH32; P400; TNRC12

Gene ID

57634

UniProt

Q96L91

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 331kDa/335kDa/339kDa/343kDa Observed MW: 400kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57634

Uniprot URL

https://www.uniprot.org/uniprot/Q96L91

AA Sequence

TLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGVLLPGAGGAAGFGMTSPPPPTSPSRTAVPPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muffle Box Furnace BFMF-1200-5
BFMF-1200-5 1 Unit

Muffle Box Furnace BFMF-1200-5

Sign In for Pricing
View Details
Recombinant KDM2A Monoclonal Antibody
AN301693L-01 50 µL

Recombinant KDM2A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant KDM2A Monoclonal Antibody
AN301693L-02 100 µL

Recombinant KDM2A Monoclonal Antibody

Sign In for Pricing
View Details
1-Iodo-hexadecane
TRC-I706500-50G 50 g

1-Iodo-hexadecane

Sign In for Pricing
View Details
Human KIF25 activation kit by CRISPRa
GA102598 1 Kit

Human KIF25 activation kit by CRISPRa

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (rCLIP/1418), CF740 conjugate, 0.1mg/mL
BNC743176-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (rCLIP/1418), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details