Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTL Rabbit pAb (APR18829N)

Product Specifications

Background

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX (DTL complex, also named CRL4 (CDT2 complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21 (CIP1, FBH1, KMT5A and SDE2. CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21 (CIP1 degradation during S phase or following UV irradiation is essential to control replication licensing. KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX (DTL complex, leading to their degradation. In undamaged proliferating cells, the DCX (DTL complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis. The DDB1-CUL4A-DTL E3 ligase complex regulates the circadian clock function by mediating the ubiquitination and degradation of CRY1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DTL Rabbit pAb (APR18829N) .

Synonyms

DTL; CDT2; DCAF2; L2DTL; RAMP

Gene ID

51514

UniProt

Q9NZJ0

Cellular Locus

Chromosome, Cytoplasm, Nucleoplasmic side, Nucleus, Nucleus membrane, Peripheral membrane protein, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/79kDa Observed MW: 90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51514

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZJ0

AA Sequence

AEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSKDSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKTLPSPVTITPSSMRKICTYFHRKSQEDFCGPEHSTEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB7B Antibody, FITC conjugated
A32702-100UG 100 µg

RAB7B Antibody, FITC conjugated

Sign In for Pricing
View Details
Max-Interacting Protein 1 (MXI1) Antibody
abx301097-01 20 µg

Max-Interacting Protein 1 (MXI1) Antibody

Sign In for Pricing
View Details
Max-Interacting Protein 1 (MXI1) Antibody
abx301097-02 50 µg

Max-Interacting Protein 1 (MXI1) Antibody

Sign In for Pricing
View Details
Max-Interacting Protein 1 (MXI1) Antibody
abx301097-03 100 µg

Max-Interacting Protein 1 (MXI1) Antibody

Sign In for Pricing
View Details
Max-Interacting Protein 1 (MXI1) Antibody
abx301097-04 200 µg

Max-Interacting Protein 1 (MXI1) Antibody

Sign In for Pricing
View Details
Max-Interacting Protein 1 (MXI1) Antibody
abx301097-05 1 mg

Max-Interacting Protein 1 (MXI1) Antibody

Sign In for Pricing
View Details