Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPZ1 Rabbit pAb (APR18827N)

Product Specifications

Background

This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP) I-vesicles. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COPZ1 Rabbit pAb (APR18819N8) .

Synonyms

COPZ1; CGI-120; COPZ; HSPC181; zeta-COP; zeta1-COP

Gene ID

22818

UniProt

P61923

Cellular Locus

COPI-coated vesicle membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/17kDa/18kDa/20kDa/21kDa Observed MW: 19kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22818

Uniprot URL

https://www.uniprot.org/uniprot/P61923

AA Sequence

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific,  10nm
GAF-512-10 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific, 10nm

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559179 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
1-Phenyl-3,4-dihydro-isoquinoline
TRC-P229440-500MG 500 mg

1-Phenyl-3,4-dihydro-isoquinoline

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), 1mg/mL
BNUM2399-50 1x 50 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), 1mg/mL

Sign In for Pricing
View Details
GABRP Human Gene Knockout Kit (CRISPR)
KN424902 1 Kit

GABRP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein
TP324784L 1 mg

IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein

Sign In for Pricing
View Details