Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFCP2L1 Rabbit pAb (APR18820N)

Product Specifications

Background

Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs. With KLF2, acts as the major effector of self-renewal that mediates induction of pluripotency downstream of LIF/STAT3 and Wnt/beta-catenin signaling (By similarity. Required for normal duct development in the salivary gland and kidney (By similarity. Coordinates the development of the kidney collecting ducts intercalated (IC and principal (PC cells, which regulate acid-base and salt-water homeostasis, respectively (By similarity. Regulates the expression of IC genes including subunits B1 and D2 of the V-ATPase complex, OXGR1, CA12, SLC4A1, AQP6 and IC-specific transcription factor FOXI1 (By similarity. Regulates also the expression of JAG1 and subsequent notch signaling in the collecting duct (By similarity. JAG1 initiates notch signaling in PCs but inhibits notch signaling in ICs (By similarity. Acts as a transcriptional suppressor that may suppress UBP1-mediated transcriptional activation (By similarity. Modulates the placental expression of CYP11A1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TFCP2L1 Rabbit pAb (APR18819N0) .

Synonyms

TFCP2L1; CRTR1; LBP-9; LBP9

Gene ID

29842

UniProt

Q9NZI6

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 54kDa Observed MW: 58kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29842

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZI6

AA Sequence

NAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-421-5p miRNA Mimic
CMM0986-01 5 nmol

Mmu-miR-421-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-421-5p miRNA Mimic
CMM0986-02 10 nmol

Mmu-miR-421-5p miRNA Mimic

Sign In for Pricing
View Details
OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]
MBS4382167-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]

Sign In for Pricing
View Details
OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]
MBS4382167-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]

Sign In for Pricing
View Details
OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]
MBS4382167-03 0.1 mg (Without BSA & Azide at 1mg/mL)

OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]

Sign In for Pricing
View Details
OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]
MBS4382167-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

OVOL2/CRE-BPa Mouse Monoclonal Antibody [Clone PCRP-OVOL2-2A1]

Sign In for Pricing
View Details