Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SART3 Rabbit pAb (APR18804N)

Product Specifications

Background

The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SART3 Rabbit pAb (APR18804N) .

Synonyms

SART3; DSAP1; P100; RP11-13G14; TIP110; p110; p110 (nrb)

Gene ID

9733

UniProt

Q15020

Cellular Locus

Cajal body, Cytoplasm, Nucleus, Nucleus speckle, nucleoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/41kDa/105kDa/109kDa Observed MW: 130kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9733

Uniprot URL

https://www.uniprot.org/uniprot/Q15020

AA Sequence

AGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC16A Antibody
8C18482-AAT 50 µg

SEC16A Antibody

Sign In for Pricing
View Details
3,5-Dihydroxyphenylpropanoic Acid 3-O-b-D-Glucuronide(>85%)
TRC-D454370-25MG 25 mg

3,5-Dihydroxyphenylpropanoic Acid 3-O-b-D-Glucuronide(>85%)

Sign In for Pricing
View Details
HIV Quantitative TaqMan RT-PCR Detection Kit
TM33740 48 Reactions

HIV Quantitative TaqMan RT-PCR Detection Kit

Sign In for Pricing
View Details
NADPH-Cytochrome c Reductase Microplate Assay Kit
RDSM030 100 Assays

NADPH-Cytochrome c Reductase Microplate Assay Kit

Sign In for Pricing
View Details
Xylotuberin
TRC-X750780-25MG 25 mg

Xylotuberin

Sign In for Pricing
View Details
Preserved Blood RNA Purification Kit I (For use with Tempus RNA Blood Tubes)
43400 50 Preparations

Preserved Blood RNA Purification Kit I (For use with Tempus RNA Blood Tubes)

Sign In for Pricing
View Details