Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA3 Rabbit pAb (APR18800N)

Product Specifications

Background

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CA3 Rabbit pAb (APR18800N) .

Synonyms

CA3; CAIII; Car3

Gene ID

761

UniProt

P07451

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=761

Uniprot URL

https://www.uniprot.org/uniprot/P07451

AA Sequence

MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNase1L3, Mouse (His)
HY-P790035 100 µg

DNase1L3, Mouse (His)

Sign In for Pricing
View Details
Human IL-35 R / gp130 & IL12Rb2 Protein, His Tag (MALS verified)
ILR-H52H8-50ug 50 µg

Human IL-35 R / gp130 & IL12Rb2 Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
MAZ Protein Vector (Mouse) (pPM-C-HA)
PV199500 500 ng

MAZ Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-RAB3B Antibody
CQA9216-01 30 µL

Anti-RAB3B Antibody

Sign In for Pricing
View Details
Anti-RAB3B Antibody
CQA9216-02 50 μL

Anti-RAB3B Antibody

Sign In for Pricing
View Details
Anti-RAB3B Antibody
CQA9216-03 100 µL

Anti-RAB3B Antibody

Sign In for Pricing
View Details