Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD2 Rabbit pAb (APR18788N)

Product Specifications

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SMARCD2 Rabbit pAb (APR18785N4) .

Synonyms

SMARCD2; BAF60B; CRACD2; PRO2451; Rsc6p; SGD2

Gene ID

6603

UniProt

Q92925

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/57kDa/58kDa Observed MW: 64kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6603

Uniprot URL

https://www.uniprot.org/uniprot/Q92925

AA Sequence

RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEATR4 (NM_203309) Human Tagged Lenti ORF Clone
RC207990L3 10 µg

HEATR4 (NM_203309) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sobrerol
HY-108289 1 Each

Sobrerol

Sign In for Pricing
View Details
DLEC1, NT (DLEC1, DLC1, Deleted in lung and esophageal cancer protein 1, Deleted in lung cancer protein 1) (MaxLight 490) discontinued
034661-ML490 100 µL

DLEC1, NT (DLEC1, DLC1, Deleted in lung and esophageal cancer protein 1, Deleted in lung cancer protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
EBLN2 Antibody
orb1328839 100 µg

EBLN2 Antibody

Sign In for Pricing
View Details
Creb3l1 3'UTR Lenti-reporter-Luc Vector
16811086 1.0 µg

Creb3l1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CYBASC3 Protein Vector (Human) (pPM-C-HA)
PV011407 500 ng

CYBASC3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details