Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD2 Rabbit pAb (APR18788N)

Product Specifications

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SMARCD2 Rabbit pAb (APR18785N4) .

Synonyms

SMARCD2; BAF60B; CRACD2; PRO2451; Rsc6p; SGD2

Gene ID

6603

UniProt

Q92925

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/57kDa/58kDa Observed MW: 64kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6603

Uniprot URL

https://www.uniprot.org/uniprot/Q92925

AA Sequence

RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK1 Monoclonal Antibody, APC-Cy7 Conjugated
bsm-33268M-APC-Cy7 100 µL

JAK1 Monoclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Phospho-TIRAP (Tyr86) Rabbit Polyclonal Antibody (PE-Cy5)
orb871505 100 µL

Phospho-TIRAP (Tyr86) Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Poliovirus Receptor Related Protein 1 (PVRL1) Antibody
abx215063 100 µg

Poliovirus Receptor Related Protein 1 (PVRL1) Antibody

Sign In for Pricing
View Details
AZGP1 Peptide - N-terminal region
orb2012158 100 µg

AZGP1 Peptide - N-terminal region

Sign In for Pricing
View Details
RNY5P6 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV747154 1.0 µg DNA

RNY5P6 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rabbit Polyclonal Neuroligin 2/NLGN2 Antibody
NBP2-41299 0.1 mg

Rabbit Polyclonal Neuroligin 2/NLGN2 Antibody

Sign In for Pricing
View Details