Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18B Rabbit pAb (APR18774N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPS18B Rabbit pAb (APR18770N5) .

Synonyms

MRPS18B; C6orf14; HSPC183; HumanS18a; MRP-S18-2; MRPS18-2; PTD017; S18amt

Gene ID

28973

UniProt

Q9Y676

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=28973

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y676

AA Sequence

MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NLRX1 Rabbit Polyclonal Antibody
TA370256 100 µL

NLRX1 Rabbit Polyclonal Antibody

Ask
View Details
Lentiviral mouse Igfbp7 shRNA (UAS) - Lentiviral mouse Igfbp7 shRNA (UAS, RFP) (25)
GTR15298610 1 Vial

Lentiviral mouse Igfbp7 shRNA (UAS) - Lentiviral mouse Igfbp7 shRNA (UAS, RFP) (25)

Ask
View Details
PTPN5 (STEP, Tyrosine-protein Phosphatase Non-receptor Type 5, Striatum-enriched Protein-tyrosine Phosphatase, Neural-specific Protein-tyrosine Phosphatase, FLJ14427) (AP) discontinued
132068-AP 100 µL

PTPN5 (STEP, Tyrosine-protein Phosphatase Non-receptor Type 5, Striatum-enriched Protein-tyrosine Phosphatase, Neural-specific Protein-tyrosine Phosphatase, FLJ14427) (AP) discontinued

Ask
View Details
Human ADM2 (Adrenomedullin 2) ELISA Kit
EK244500 96 Well

Human ADM2 (Adrenomedullin 2) ELISA Kit

Ask
View Details