Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP3 Rabbit pAb (APR18764N)

Product Specifications

Background

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DUSP3 Rabbit pAb (APR18764N) .

Synonyms

DUSP3; VHR

Gene ID

1845

UniProt

P51452

Cellular Locus

Nucleus

Applications

WB (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/20kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1845

Uniprot URL

https://www.uniprot.org/uniprot/P51452

AA Sequence

MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR519e Human MicroRNA Expression Plasmid (MI0003145)
SC400472 10 µg

MIR519e Human MicroRNA Expression Plasmid (MI0003145)

Sign In for Pricing
View Details
XFD647 Anti-non-human primates/ human CD35 Antibody *E11*
10350181-AAT 500 Tests

XFD647 Anti-non-human primates/ human CD35 Antibody *E11*

Sign In for Pricing
View Details
Human CD58 AssayLite™ Antibody (FITC Conjugate)
32573-05141 2x 75 µg

Human CD58 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Narfl (NM_001013183) Rat Tagged ORF Clone Lentiviral Particle
RR207886L3V 200 µL

Narfl (NM_001013183) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - APC
MBS8326070-01 0.1 mL

Mouse Anti-Monkey IgG (H&L) - APC

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - APC
MBS8326070-02 0.5 mL

Mouse Anti-Monkey IgG (H&L) - APC

Sign In for Pricing
View Details