Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO6 Rabbit pAb (APR18753N)

Product Specifications

Background

This gene encodes a multi-pass transmembrane protein that belongs to the anoctamin family. This protein is an essential component for the calcium-dependent exposure of phosphatidylserine on the cell surface. The scrambling of phospholipid occurs in various biological systems, such as when blood platelets are activated, they expose phosphatidylserine to trigger the clotting system. Mutations in this gene are associated with Scott syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANO6 Rabbit pAb (APR18752N0) .

Synonyms

ANO6; BDPLT7; SCTS; TMEM16F

Gene ID

196527

UniProt

Q4KMQ2

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa/106kDa/108kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=196527

Uniprot URL

https://www.uniprot.org/uniprot/Q4KMQ2

AA Sequence

IPRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Plasmodium Chabaudi CG10 Protein (Yeast)
VAng-Wyb7706-inquire Inquire

Recombinant Plasmodium Chabaudi CG10 Protein (Yeast)

Sign In for Pricing
View Details
PDDC1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-04837 0.1 mg

PDDC1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial
MBS1315097-01 0.5 mg (E-Coli)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial
MBS1315097-02 0.05 mg (Baculovirus)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial
MBS1315097-03 0.5 mg (Yeast)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial
MBS1315097-04 0.05 mg (Mammalian-Cell)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein DivIB (divIB), partial

Sign In for Pricing
View Details