Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX5 Rabbit pAb (APR18750N)

Product Specifications

Background

This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. Paired box transcription factors are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t (9;14) (p13; q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PAX5 Rabbit pAb (APR18743N8) .

Synonyms

PAX5; ALL3; BSAP

Gene ID

5079

UniProt

Q02548

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/32kDa/34kDa/35kDa/37kDa/38kDa/42kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5079

Uniprot URL

https://www.uniprot.org/uniprot/Q02548

AA Sequence

MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6R1P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV737998 1.0 µg DNA

OR6R1P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
GCG (Glucagon) (Biotin)
MBS6142043-01 0.1 mL

GCG (Glucagon) (Biotin)

Sign In for Pricing
View Details
GCG (Glucagon) (Biotin)
MBS6142043-02 5x 0.1 mL

GCG (Glucagon) (Biotin)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0070 protein bbp_550 (bbp_550)
MBS7036931-01 0.02 mg

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0070 protein bbp_550 (bbp_550)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0070 protein bbp_550 (bbp_550)
MBS7036931-02 0.1 mg

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0070 protein bbp_550 (bbp_550)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0070 protein bbp_550 (bbp_550)
MBS7036931-03 5x 0.1 mg

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0070 protein bbp_550 (bbp_550)

Sign In for Pricing
View Details