Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BYSL Rabbit pAb (APR18709N)

Product Specifications

Background

Bystin is expressed as a 2-kb major transcript and a 3.6-kb minor transcript in SNG-M cells and in human trophoblastic teratocarcinoma HT-H cells. Protein binding assays determined that bystin binds directly to trophinin and tastin, and that binding is enhanced when cytokeratins 8 and 18 are present. Immunocytochemistry of HT-H cells showed that bystin colocalizes with trophinin, tastin, and the cytokeratins, suggesting that these molecules form a complex in trophectoderm cells at the time of implantation. Using immunohistochemistry it was determined that trophinin and bystin are found in the placenta from the sixth week of pregnancy. Both proteins were localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the levels of trophinin, tastin, and bystin decreased and then disappeared from placental villi.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BYSL Rabbit pAb (APR18709N) .

Synonyms

BYSL; BYSTIN; bystin

Gene ID

705

UniProt

Q13895

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=705

Uniprot URL

https://www.uniprot.org/uniprot/Q13895

AA Sequence

HAEVVVDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 550)
MBS6356918-01 0.1 mL

TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 550)

Ask
View Details
TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 550)
MBS6356918-02 5x 0.1 mL

TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 550)

Ask
View Details
Lentiviral mouse Hesx1 shRNA (UAS) - Lentiviral mouse Hesx1 shRNA (UAS) plasmid
GTR15240031 1 Vial

Lentiviral mouse Hesx1 shRNA (UAS) - Lentiviral mouse Hesx1 shRNA (UAS) plasmid

Ask
View Details
DLX2 (Distal-less Homeobox 2, TES-1, TES1) (FITC)
245389-FITC 100 µL

DLX2 (Distal-less Homeobox 2, TES-1, TES1) (FITC)

Ask
View Details
Anti-DNAJB13 Antibody
CTA3347-01 30 µL

Anti-DNAJB13 Antibody

Ask
View Details
Anti-DNAJB13 Antibody
CTA3347-02 50 μL

Anti-DNAJB13 Antibody

Ask
View Details