Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD86 Rabbit pAb (APR18708N)

Product Specifications

Background

This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD86 Rabbit pAb (APR18708N) .

Synonyms

B7-2; B7.2; B70; CD28LG2; LAB72; CD86

Gene ID

942

UniProt

P42081

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Applications

WB (Human cells, Rattus norvegicus, Mus musculus) IF (Rattus norvegicus) FC (Mus musculus) IHC (Rattus norvegicus) ICC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/24kDa/28kDa/31kDa/37kDa Observed MW: 74KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=942

Uniprot URL

https://www.uniprot.org/uniprot/P42081

AA Sequence

AYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1ra/IL-1F3 Quantikine SixPak (6 Plates)
SRA00B 6x 96 Tests

Human IL-1ra/IL-1F3 Quantikine SixPak (6 Plates)

Sign In for Pricing
View Details
CHRNB4 Protein Vector (Human) (pPM-C-HA)
PV069475 500 ng

CHRNB4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TRAF7  polyclonal antibody
BS76398 50ul

TRAF7 polyclonal antibody

Sign In for Pricing
View Details
RIIAD1 CRISPR Knock Out 293T Cell Line (Human)
39582141 1x 10^6 Cells / 1.0 mL

RIIAD1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CBLC (Signal Transduction Protein CBL-C, RING Finger Protein 57, SH3-binding Protein CBL-3, SH3-binding Protein CBL-C, CBL3, RNF57) (MaxLight 405)
MBS6372382-01 0.1 mL

CBLC (Signal Transduction Protein CBL-C, RING Finger Protein 57, SH3-binding Protein CBL-3, SH3-binding Protein CBL-C, CBL3, RNF57) (MaxLight 405)

Sign In for Pricing
View Details
CBLC (Signal Transduction Protein CBL-C, RING Finger Protein 57, SH3-binding Protein CBL-3, SH3-binding Protein CBL-C, CBL3, RNF57) (MaxLight 405)
MBS6372382-02 5x 0.1 mL

CBLC (Signal Transduction Protein CBL-C, RING Finger Protein 57, SH3-binding Protein CBL-3, SH3-binding Protein CBL-C, CBL3, RNF57) (MaxLight 405)

Sign In for Pricing
View Details