TIMP3 Rabbit pAb (APR18706N)
Product Specifications
Background
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM) . Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIMP3 Rabbit pAb (APR18702N6) .
Synonyms
TIMP3; HSMRK222; K222; K222TA2; SFD
Gene ID
7078
UniProt
P35625
Cellular Locus
Secreted, extracellular matrix, extracellular space
Applications
IHC (Gallus gallus) WB (Mus musculus)
Dilution
WB 1:500 - 1:2000
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 24kDa Observed MW: 20kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7078
Uniprot URL
https://www.uniprot.org/uniprot/P35625
AA Sequence
YQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3496407 1.0 µg DNA
Hnrnpa2b1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
F9046-10P 1 mg
FOXD3, Control Peptide (Forkhead Box D3, HFH2, HNF-3 Forkhead Transcription Factor Genesis) discontinued
Sign In for Pricing
View Details 033690-PE 200 µL
CDKL1, CT (CDKL1, Cyclin-dependent kinase-like 1, Protein kinase p42 KKIALRE, Serine/threonine-protein kinase KKIALRE) (PE) discontinued
Sign In for Pricing
View Details 
MBS6378955-01 0.1 mL
FTH1 (Ferritin Heavy Chain, Ferritin H Subunit, Cell Proliferation-inducing Gene 15 Protein, PIG15, OK/SW-cl.84, FTHL6, FTH) (AP)
Sign In for Pricing
View Details MBS6378955-02 5x 0.1 mL
FTH1 (Ferritin Heavy Chain, Ferritin H Subunit, Cell Proliferation-inducing Gene 15 Protein, PIG15, OK/SW-cl.84, FTHL6, FTH) (AP)
Sign In for Pricing
View Details 