Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Rabbit pAb (APR18706N)

Product Specifications

Background

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM) . Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIMP3 Rabbit pAb (APR18702N6) .

Synonyms

TIMP3; HSMRK222; K222; K222TA2; SFD

Gene ID

7078

UniProt

P35625

Cellular Locus

Secreted, extracellular matrix, extracellular space

Applications

IHC (Gallus gallus) WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7078

Uniprot URL

https://www.uniprot.org/uniprot/P35625

AA Sequence

YQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Chondroadherin (CHAD) ELISA
KBH8961 1x 96 Well

GENLISA Human Chondroadherin (CHAD) ELISA

Sign In for Pricing
View Details
RN5S483 ORF Vector (Human) (pORF)
ORF029407 1.0 µg DNA

RN5S483 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human RBP4 Recombinant Protein DDDDK Tag
MBS8433267-01 0.01 mg

Human RBP4 Recombinant Protein DDDDK Tag

Sign In for Pricing
View Details
Human RBP4 Recombinant Protein DDDDK Tag
MBS8433267-02 0.05 mg

Human RBP4 Recombinant Protein DDDDK Tag

Sign In for Pricing
View Details
Human RBP4 Recombinant Protein DDDDK Tag
MBS8433267-03 5x 0.05 mg

Human RBP4 Recombinant Protein DDDDK Tag

Sign In for Pricing
View Details
Trail (Tnfsf10, Tumor Necrosis Factor Ligand Superfamily Member 10, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, CD253, A330042I21Rik, AI448571) (Biotin) discontinued
143686-01 25 µg

Trail (Tnfsf10, Tumor Necrosis Factor Ligand Superfamily Member 10, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, CD253, A330042I21Rik, AI448571) (Biotin) discontinued

Sign In for Pricing
View Details