Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Rabbit pAb (APR18706N)

Product Specifications

Background

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM) . Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIMP3 Rabbit pAb (APR18702N6) .

Synonyms

TIMP3; HSMRK222; K222; K222TA2; SFD

Gene ID

7078

UniProt

P35625

Cellular Locus

Secreted, extracellular matrix, extracellular space

Applications

IHC (Gallus gallus) WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7078

Uniprot URL

https://www.uniprot.org/uniprot/P35625

AA Sequence

YQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M7-225-595-BR Pre-sized Labels for Printers
323214 250 Roll (250 Label (s) x 1 Roll)

M7-225-595-BR Pre-sized Labels for Printers

Sign In for Pricing
View Details
2-Chloro-3-methylphenylboronic acid
416617-01 100 mg

2-Chloro-3-methylphenylboronic acid

Sign In for Pricing
View Details
2-Chloro-3-methylphenylboronic acid
416617-02 250 mg

2-Chloro-3-methylphenylboronic acid

Sign In for Pricing
View Details
TIPS,200UL,NAT,PP,NS,STK RK,480/4800
4803 480/pk

TIPS,200UL,NAT,PP,NS,STK RK,480/4800

Sign In for Pricing
View Details
Olr1087 (NM_001000418) Rat Untagged Clone
RN204862 10 µg

Olr1087 (NM_001000418) Rat Untagged Clone

Sign In for Pricing
View Details
Bovine Islet Amyloid Polypeptide (IAPP) ELISA Kit
NSL0406Bo 96 Tests

Bovine Islet Amyloid Polypeptide (IAPP) ELISA Kit

Sign In for Pricing
View Details