Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK6 Rabbit pAb (APR18697N)

Product Specifications

Background

This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The encoded preproprotein is proteolytically processed to generate the mature protease. Expression of this protease is regulated by steroid hormones and may be elevated in multiple human cancers and in serum from psoriasis patients. The encoded protease may participate in the cleavage of amyloid precursor protein and alpha-synuclein, thus implicating this protease in Alzheimer's and Parkinson's disease, respectively. This gene is located in a gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLK6 Rabbit pAb (APR18695N2) .

Synonyms

KLK6; Bssp; Klk7; PRSS18; PRSS9; SP59; hK6

Gene ID

5653

UniProt

Q92876

Cellular Locus

Cytoplasm, Microsome, Mitochondrion, Nucleus, Secreted, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 4kDa/15kDa/26kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5653

Uniprot URL

https://www.uniprot.org/uniprot/Q92876

AA Sequence

AASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Interleukin 6 Receptor (IL6R) Antibody
abx102269-01 100 µL

Interleukin 6 Receptor (IL6R) Antibody

Ask
View Details
Interleukin 6 Receptor (IL6R) Antibody
abx102269-02 200 µL

Interleukin 6 Receptor (IL6R) Antibody

Ask
View Details
Interleukin 6 Receptor (IL6R) Antibody
abx102269-03 1 mL

Interleukin 6 Receptor (IL6R) Antibody

Ask
View Details
Mouse Polyclonal GIMAP6 Antibody
H00474344-B01P 0.05 mg

Mouse Polyclonal GIMAP6 Antibody

Ask
View Details
RNF36, ID (K251) (Tripartite motif-containing protein 69, RING finger protein 36, RFP-like domain-containing protein trimless, HSD34, HSD-34, TRIM69) (FITC)
MBS6497964-01 0.2 mL

RNF36, ID (K251) (Tripartite motif-containing protein 69, RING finger protein 36, RFP-like domain-containing protein trimless, HSD34, HSD-34, TRIM69) (FITC)

Ask
View Details
RNF36, ID (K251) (Tripartite motif-containing protein 69, RING finger protein 36, RFP-like domain-containing protein trimless, HSD34, HSD-34, TRIM69) (FITC)
MBS6497964-02 5x 0.2 mL

RNF36, ID (K251) (Tripartite motif-containing protein 69, RING finger protein 36, RFP-like domain-containing protein trimless, HSD34, HSD-34, TRIM69) (FITC)

Ask
View Details