Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytokeratin 1 (KRT1) Rabbit pAb (APR18687N)

Product Specifications

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cytokeratin 1 (KRT1) Rabbit pAb (APR18687N) .

Synonyms

KRT1; CK1; EHK; EHK1; EPPK; K1; KRT1A; NEPPK; keratin 1

Gene ID

3848

UniProt

P04264

Cellular Locus

Cell membrane

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa Observed MW: 66kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3848

Uniprot URL

https://www.uniprot.org/uniprot/P04264

AA Sequence

FLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYEDIAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL18AP16-set siRNA/shRNA/RNAi Lentivector (Human)
40929091 4x 500 ng

RPL18AP16-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Tim44 (A-9) HRP
sc-390755 HRP 200 µg/mL

Tim44 (A-9) HRP

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Leupaxin (LPXN)
MBS2066742-01 0.1 mL

APC-Linked Polyclonal Antibody to Leupaxin (LPXN)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Leupaxin (LPXN)
MBS2066742-02 0.2 mL

APC-Linked Polyclonal Antibody to Leupaxin (LPXN)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Leupaxin (LPXN)
MBS2066742-03 0.5 mL

APC-Linked Polyclonal Antibody to Leupaxin (LPXN)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Leupaxin (LPXN)
MBS2066742-04 1 mL

APC-Linked Polyclonal Antibody to Leupaxin (LPXN)

Sign In for Pricing
View Details