Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JunD Rabbit pAb (APR18684N)

Product Specifications

Background

The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality JunD Rabbit pAb (APR18684N) .

Synonyms

JUND; AP-1

Gene ID

3727

UniProt

P17535

Cellular Locus

Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3727

Uniprot URL

https://www.uniprot.org/uniprot/P17535

AA Sequence

METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1810037I17Rik Mouse qPCR Template Standard (NM_024461)
MK200018 1 Kit

1810037I17Rik Mouse qPCR Template Standard (NM_024461)

Sign In for Pricing
View Details
NPHS2 Recombinant Rabbit mAb
BS49405 50 ul

NPHS2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
GIMAP4 Polyclonal Antibody, APC-Cy7 Conjugated
bs-8270R-APC-Cy7 100 µL

GIMAP4 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
TRIM68, CT (TRIM68, GC109, RNF137, SS56, E3 ubiquitin-protein ligase TRIM68, RING finger protein 137, SSA protein SS-56, Tripartite motif-containing protein 68) (APC)
MBS6358562-01 0.2 mL

TRIM68, CT (TRIM68, GC109, RNF137, SS56, E3 ubiquitin-protein ligase TRIM68, RING finger protein 137, SSA protein SS-56, Tripartite motif-containing protein 68) (APC)

Sign In for Pricing
View Details
TRIM68, CT (TRIM68, GC109, RNF137, SS56, E3 ubiquitin-protein ligase TRIM68, RING finger protein 137, SSA protein SS-56, Tripartite motif-containing protein 68) (APC)
MBS6358562-02 5x 0.2 mL

TRIM68, CT (TRIM68, GC109, RNF137, SS56, E3 ubiquitin-protein ligase TRIM68, RING finger protein 137, SSA protein SS-56, Tripartite motif-containing protein 68) (APC)

Sign In for Pricing
View Details
IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (Biotin) discontinued
143592-01 25 µg

IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (Biotin) discontinued

Sign In for Pricing
View Details