Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIF1α Rabbit pAb (APR18678N)

Product Specifications

Background

This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HIF1α Rabbit pAb (APR18676N5) .

Synonyms

HIF1A; HIF-1-alpha; HIF-1A; HIF-1alpha; HIF1; HIF1-ALPHA; MOP1; PASD8; bHLHe78

Gene ID

3091

UniProt

Q16665

Cellular Locus

Cytoplasm, Nucleus, Nucleus speckle

Applications

WB (N9 cells, Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus) IF (Homo sapiens) Co-IP (Homo sapiens) IHC (Gallus gallus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 82kDa/92kDa/95kDa Observed MW: 120KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3091

Uniprot URL

https://www.uniprot.org/uniprot/Q16665

AA Sequence

RKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERIT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

E3 Ubiquitin-protein Ligase Parkin, Recombinant, Rat, aa1-465, His-Tag, Myc-Tag
584323 20 µg

E3 Ubiquitin-protein Ligase Parkin, Recombinant, Rat, aa1-465, His-Tag, Myc-Tag

Ask
View Details
APPL2 (DIP13B, DCC-interacting Protein 13-beta, Dip13-beta, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 2, FLJ10659) (MaxLight 490)
MBS6200477-01 0.1 mL

APPL2 (DIP13B, DCC-interacting Protein 13-beta, Dip13-beta, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 2, FLJ10659) (MaxLight 490)

Ask
View Details
APPL2 (DIP13B, DCC-interacting Protein 13-beta, Dip13-beta, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 2, FLJ10659) (MaxLight 490)
MBS6200477-02 5x 0.1 mL

APPL2 (DIP13B, DCC-interacting Protein 13-beta, Dip13-beta, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 2, FLJ10659) (MaxLight 490)

Ask
View Details
PRMT1 (NM_001536) Human Recombinant Protein
TP324239 20 µg

PRMT1 (NM_001536) Human Recombinant Protein

Ask
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) PSBJ Polyclonal Antibody
MBS7151982 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) PSBJ Polyclonal Antibody

Ask
View Details
GREM1 (CKTSF1B1, DAND2, DRM, Gremlin-1, Cell Proliferation-inducing Gene 2 Protein, Cysteine Knot Superfamily 1, BMP Antagonist 1, DAN Domain Family Member 2, Down-regulated in Mos-transformed Cells Protein, Increased in High Glucose Protein 2)
127532 100 µg

GREM1 (CKTSF1B1, DAND2, DRM, Gremlin-1, Cell Proliferation-inducing Gene 2 Protein, Cysteine Knot Superfamily 1, BMP Antagonist 1, DAN Domain Family Member 2, Down-regulated in Mos-transformed Cells Protein, Increased in High Glucose Protein 2)

Ask
View Details