Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta Receptor II (TGFBR2) Rabbit pAb (APR18649N)

Product Specifications

Background

This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TGF beta Receptor II (TGFBR2) Rabbit pAb (APR18643N8) .

Synonyms

AAT3; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; TAAD2; TGFR-2; TGFbeta-RII; TGF beta Receptor II; TGFBR2

Gene ID

7048

UniProt

P37173

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Applications

WB (Mus musculus, Gentianella acuta)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa/67kDa Observed MW: 90KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7048

Uniprot URL

https://www.uniprot.org/uniprot/P37173

AA Sequence

TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-ROR gamma
YF-PA14415 100 ug

anti-ROR gamma

Sign In for Pricing
View Details
GASP-1/WFIKKN2 Protein, Human, Recombinant (His Tag)
PH51867M2 50 µg

GASP-1/WFIKKN2 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SLC35G1 (Solute carrier family 35 member G1) Full Length
MPC2077K Each

Magic™ Membrane Protein Human SLC35G1 (Solute carrier family 35 member G1) Full Length

Sign In for Pricing
View Details
Human Tribbles homolog 3 (TRIB3) Elisa Kit
EK713975 96 Well

Human Tribbles homolog 3 (TRIB3) Elisa Kit

Sign In for Pricing
View Details
Ezr sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4637808 1.0 µg DNA

Ezr sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-Glycolipid Antibody (AGA) Guinea Pig ELISA Kit
B3380 96 Tests

Anti-Glycolipid Antibody (AGA) Guinea Pig ELISA Kit

Sign In for Pricing
View Details