Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta Receptor II (TGFBR2) Rabbit pAb (APR18649N)

Product Specifications

Background

This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TGF beta Receptor II (TGFBR2) Rabbit pAb (APR18643N8) .

Synonyms

AAT3; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; TAAD2; TGFR-2; TGFbeta-RII; TGF beta Receptor II; TGFBR2

Gene ID

7048

UniProt

P37173

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Applications

WB (Mus musculus, Gentianella acuta)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa/67kDa Observed MW: 90KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7048

Uniprot URL

https://www.uniprot.org/uniprot/P37173

AA Sequence

TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serinc1 (NM_019760) Mouse Tagged ORF Clone
MG207238 10 µg

Serinc1 (NM_019760) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GGNBP2 Protein Vector (Rat) (pPB-N-His)
PV270075 500 ng

GGNBP2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
TRIM49 AAV Vector (Human) (CMV)
47795101 1 µg

TRIM49 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Platelet-activating Factor acetylhydrolase (PLA2G7) Guinea Pig ELISA Kit
F9483 96 Tests

Platelet-activating Factor acetylhydrolase (PLA2G7) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Human MDFI Pre-designed siRNA Set A
SI009377A 1 Each

Human MDFI Pre-designed siRNA Set A

Sign In for Pricing
View Details
ERVV-1 Protein Vector (Human) (pPB-N-His)
PV076130 500 ng

ERVV-1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details