Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VDR Rabbit pAb (APR18620N)

Product Specifications

Background

This gene encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding different proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VDR Rabbit pAb (APR18620N) .

Synonyms

VDR; NR1I1; PPP1R163

Gene ID

7421

UniProt

P11473

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/53kDa Observed MW: 48KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7421

Uniprot URL

https://www.uniprot.org/uniprot/P11473

AA Sequence

QQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc110 AAV siRNA Pooled Vector
15175164 1.0 µg

Ccdc110 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
APC/iFluor® 750 Anti-human CD161 Antibody *HP-3G10*
116101G1-AAT 100 Tests

APC/iFluor® 750 Anti-human CD161 Antibody *HP-3G10*

Sign In for Pricing
View Details
RuCl2[ (S) - (DM-BINAP) ][ (S, S) -DPEN]
sc-229148 50 mg

RuCl2[ (S) - (DM-BINAP) ][ (S, S) -DPEN]

Sign In for Pricing
View Details
PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody [Clone:7A7]
E45M15104 100 µg

PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody [Clone:7A7]

Sign In for Pricing
View Details
KIAA0513 (NM_001286566) Human Tagged ORF Clone
RG237994 10 µg

KIAA0513 (NM_001286566) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394), APC
MBS1584884-01 50 Tests

Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394), APC

Sign In for Pricing
View Details