Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RALA Rabbit pAb (APR18619N)

Product Specifications

Background

The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RALA Rabbit pAb (APR18619N) .

Synonyms

RALA; RAL

Gene ID

5898

UniProt

P11233

Cellular Locus

Cell membrane, Cell surface, Cleavage furrow, Cytoplasmic side, Lipid-anchor, Midbody

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5898

Uniprot URL

https://www.uniprot.org/uniprot/P11233

AA Sequence

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IKB beta (Ser23) Polyclonal Antibody, PE-Cy7 Conjugated
bs-3191R-PE-Cy7 100 µL

Phospho-IKB beta (Ser23) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Ffar1 Mouse shRNA Plasmid (Locus ID 233081)
TL507023 1 Kit

Ffar1 Mouse shRNA Plasmid (Locus ID 233081)

Sign In for Pricing
View Details
Anti-Human SLC39A6 Antibody (SAA1475), FITC
FHG52911 100 Tests

Anti-Human SLC39A6 Antibody (SAA1475), FITC

Sign In for Pricing
View Details
Human PIINP / N-terminal propeptide of Collagen alpha-1 (II) chain Recombinant Protein
R2180h 1 Each

Human PIINP / N-terminal propeptide of Collagen alpha-1 (II) chain Recombinant Protein

Sign In for Pricing
View Details
Recombinant S Protein RBD (Mammalian, A435S, C-6His)
DRA77-50ug 50 µg

Recombinant S Protein RBD (Mammalian, A435S, C-6His)

Sign In for Pricing
View Details
Zfp438 (NM_001107358) Rat Tagged Lenti ORF Clone
RR203951L3 10 µg

Zfp438 (NM_001107358) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details