Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RALA Rabbit pAb (APR18619N)

Product Specifications

Background

The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RALA Rabbit pAb (APR18619N) .

Synonyms

RALA; RAL

Gene ID

5898

UniProt

P11233

Cellular Locus

Cell membrane, Cell surface, Cleavage furrow, Cytoplasmic side, Lipid-anchor, Midbody

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5898

Uniprot URL

https://www.uniprot.org/uniprot/P11233

AA Sequence

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab5a Mouse mAb
E2222686 100 µL

Rab5a Mouse mAb

Sign In for Pricing
View Details
2- (1H-Pyrazol-3-yl) -1,3-thiazole
OR110205-01 250 mg

2- (1H-Pyrazol-3-yl) -1,3-thiazole

Sign In for Pricing
View Details
2- (1H-Pyrazol-3-yl) -1,3-thiazole
OR110205-02 1 g

2- (1H-Pyrazol-3-yl) -1,3-thiazole

Sign In for Pricing
View Details
C13orf26 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0294805 3x 1.0 µg

C13orf26 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
T-complex Protein 1 delta (T-complex Protein 1 delta Subunit, TCP1 delta, TCP-1 delta, Chaperonin Containing T-complex Polypeptide 1 delta Subunit, CCT delta, CCT-delta, CCTD, Chaperonin Containing TCP1 Subunit 4 (delta), CCT4, MGC126164, MGC126165, Stimulator of TAR RNA-binding, SRB) (MaxLight 650) discontinued
T2035-25-ML650 100 µL

T-complex Protein 1 delta (T-complex Protein 1 delta Subunit, TCP1 delta, TCP-1 delta, Chaperonin Containing T-complex Polypeptide 1 delta Subunit, CCT delta, CCT-delta, CCTD, Chaperonin Containing TCP1 Subunit 4 (delta), CCT4, MGC126164, MGC126165, Stimulator of TAR RNA-binding, SRB) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rat MHC Class I Antibody (RT1A) (Biotin)
GWB-1926C8 0.1 mg

Rat MHC Class I Antibody (RT1A) (Biotin)

Sign In for Pricing
View Details