Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC12A2 Rabbit pAb (APR18573N)

Product Specifications

Background

The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC12A2 Rabbit pAb (APR18569N5) .

Synonyms

SLC12A2; BSC; BSC2; NKCC1; PPP1R141

Gene ID

6558

UniProt

P55011

Cellular Locus

Membrane, Multi-pass membrane protein

Applications

WB (Mus musculus, Sus scrofa)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 129kDa/131kDa Observed MW: 170kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6558

Uniprot URL

https://www.uniprot.org/uniprot/P55011

AA Sequence

GEASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor XII (F12) Rabbit Polyclonal Antibody
TA346198 100 µL

Factor XII (F12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LCA5L Polyclonal Antibody, PE-Cy5 Conjugated
bs-9972R-PE-Cy5 100 µL

LCA5L Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Human MUC8 Pre-designed siRNA Set A
SI010052A 1 Each

Human MUC8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GRINA, ID (GRINA, LFG1, NMDARA1, TMBIM3, Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit, Putative MAPK-activating protein PM02, Transmembrane BAX inhibitor motif-containing protein 3) (MaxLight
MBS6304476-01 0.1 mL

GRINA, ID (GRINA, LFG1, NMDARA1, TMBIM3, Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit, Putative MAPK-activating protein PM02, Transmembrane BAX inhibitor motif-containing protein 3) (MaxLight

Sign In for Pricing
View Details
GRINA, ID (GRINA, LFG1, NMDARA1, TMBIM3, Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit, Putative MAPK-activating protein PM02, Transmembrane BAX inhibitor motif-containing protein 3) (MaxLight
MBS6304476-02 5x 0.1 mL

GRINA, ID (GRINA, LFG1, NMDARA1, TMBIM3, Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit, Putative MAPK-activating protein PM02, Transmembrane BAX inhibitor motif-containing protein 3) (MaxLight

Sign In for Pricing
View Details
Recombinant Human DNase-I protein (His tag)
MBS2570776-01 0.02 mg

Recombinant Human DNase-I protein (His tag)

Sign In for Pricing
View Details