Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN3 Rabbit pAb (APR18557N)

Product Specifications

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLDN3 Rabbit pAb (APR18556N0) .

Synonyms

CLDN3; C7orf1; CPE-R2; CPETR2; HRVP1; RVP1; claudin-3

Gene ID

1365

UniProt

O15551

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, tight junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1365

Uniprot URL

https://www.uniprot.org/uniprot/O15551

AA Sequence

TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUL1 Protein Vector (Rat) (pPM-C-HA)
PV283724 500 ng

MUL1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Plasmodium falciparum Aspartic acid-rich protein
MBS1221696-01 0.02 mg (E-Coli)

Recombinant Plasmodium falciparum Aspartic acid-rich protein

Sign In for Pricing
View Details
Recombinant Plasmodium falciparum Aspartic acid-rich protein
MBS1221696-02 0.1 mg (E-Coli)

Recombinant Plasmodium falciparum Aspartic acid-rich protein

Sign In for Pricing
View Details
Recombinant Plasmodium falciparum Aspartic acid-rich protein
MBS1221696-03 0.02 mg (Yeast)

Recombinant Plasmodium falciparum Aspartic acid-rich protein

Sign In for Pricing
View Details
Recombinant Plasmodium falciparum Aspartic acid-rich protein
MBS1221696-04 0.1 mg (Yeast)

Recombinant Plasmodium falciparum Aspartic acid-rich protein

Sign In for Pricing
View Details
Recombinant Plasmodium falciparum Aspartic acid-rich protein
MBS1221696-05 0.02 mg (Baculovirus)

Recombinant Plasmodium falciparum Aspartic acid-rich protein

Sign In for Pricing
View Details