Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAK4 Rabbit pAb (APR18553N)

Product Specifications

Background

PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PAK4 Rabbit pAb (APR18551N6) .

Synonyms

PAK4

Gene ID

10298

UniProt

O96013

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa/48kDa/54kDa/64kDa Observed MW: 70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10298

Uniprot URL

https://www.uniprot.org/uniprot/O96013

AA Sequence

EPATTARGGPGKAGSRGRFAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPLSGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)
MBS6497419-01 0.1 mL

RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)

Ask
View Details
RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)
MBS6497419-02 5x 0.1 mL

RAI3, CT (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, GPRC5A, GPCR5A, RAIG1) (MaxLight 750)

Ask
View Details
Spike (B.1.617.2.1; Delta Plus Variant) (SARS-CoV-2) Pseudotyped Lentivirus (eGFP Reporter)
78219-1 100 µL

Spike (B.1.617.2.1; Delta Plus Variant) (SARS-CoV-2) Pseudotyped Lentivirus (eGFP Reporter)

Ask
View Details
Macrophage Inflammatory Protein 1 gamma, Murine (MIP-1g) (Biotin) discontinued
M1202-41A-Biotin 100 µL

Macrophage Inflammatory Protein 1 gamma, Murine (MIP-1g) (Biotin) discontinued

Ask
View Details
AARSD1 Human shRNA Lentiviral Particle (Locus ID 80755)
TL306932V 500 µL Each

AARSD1 Human shRNA Lentiviral Particle (Locus ID 80755)

Ask
View Details