Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEDD8 Rabbit pAb (APR18543N)

Product Specifications

Background

Nedd8 is an 81 amino acid Ub-like protein. It is conjugated to protein substrates in much the same way as Ub, using the E1, E2, E3 cascade. The specific E1 used is a heterodimer of APPBP1/UBA3. Two E2s have been discovered to follow called Ubc12 and Ube2F. Neddylation causes conformational change of the Cullin protein in the E3 called cullin-RING ligases (CRLs), which enhances the E3 Ub ligase activity of CRLs.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NEDD8 Rabbit pAb (APR18543N) .

Synonyms

NEDD8; NEDD-8

Gene ID

4738

UniProt

Q15843

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4738

Uniprot URL

https://www.uniprot.org/uniprot/Q15843

AA Sequence

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 calcium binding protein A11 Antibody / S100A11
orb1824402-01 20 µg

S100 calcium binding protein A11 Antibody / S100A11

Sign In for Pricing
View Details
S100 calcium binding protein A11 Antibody / S100A11
orb1824402-02 100 µg

S100 calcium binding protein A11 Antibody / S100A11

Sign In for Pricing
View Details
ZNF263 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-12217R-BF488 100 µL

ZNF263 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Receptor TNFRSF-interacting serine-threonine Kinase 2 (RIPK2) Human ELISA Kit
G6846 96 Tests

Receptor TNFRSF-interacting serine-threonine Kinase 2 (RIPK2) Human ELISA Kit

Sign In for Pricing
View Details
RPL36P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1984007 1.0 µg DNA

RPL36P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Gzf1 shRNA (UAS) - Lentiviral mouse Gzf1 shRNA (UAS, iRFP) (25)
GTR15266342 1 Vial

Lentiviral mouse Gzf1 shRNA (UAS) - Lentiviral mouse Gzf1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details