Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC3 Rabbit pAb (APR18538N)

Product Specifications

Background

This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EXOSC3 Rabbit pAb (APR18538N) .

Synonyms

EXOSC3; CGI-102; PCH1B; RRP40; Rrp40p; bA3J10.7; hRrp-40; p10

Gene ID

51010

UniProt

Q9NQT5

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/29kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51010

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQT5

AA Sequence

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMPR1A, NT (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (APC) discontinued
B2553-62-APC 200 µL

BMPR1A, NT (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (APC) discontinued

Sign In for Pricing
View Details
Lentiviral human KIAA0895 shRNA (UAS) - Lentiviral human KIAA0895 shRNA (UAS, RFP) (100)
GTR15103980 1 Vial

Lentiviral human KIAA0895 shRNA (UAS) - Lentiviral human KIAA0895 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Parainfluenza Virus Type 2 Antigen
BA1262VS 1mg

Parainfluenza Virus Type 2 Antigen

Sign In for Pricing
View Details
HAT1, NT (Histone Acetyltransferase Type B Catalytic Subunit) (MaxLight 650) discontinued
H1823-03-ML650 100 µL

HAT1, NT (Histone Acetyltransferase Type B Catalytic Subunit) (MaxLight 650) discontinued

Sign In for Pricing
View Details
LAMP2 Blocking Peptide
3900BP-50 50 μg

LAMP2 Blocking Peptide

Sign In for Pricing
View Details
TTC14 Rabbit Polyclonal Antibody
orb3013815 100 µL

TTC14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details