Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRTN Rabbit pAb (APR18536N)

Product Specifications

Background

The protein encoded by this gene may play a role in DNA repair during replication of damaged DNA. This protein recruits valosin containing protein (p97) to stalled DNA replication forks where it may prevent excessive translesional DNA synthesis and limit the number of DNA-damage induced mutations. It may also be involved in replication-related G2/M-checkpoint regulation. Deficiency of a similar protein in mouse causes chromosomal instability and progeroid phenotypes. Mutations in this gene have been associated with Ruijs-Aalfs syndrome (RJALS) . Alternatively spliced transcript variants have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPRTN Rabbit pAb (APR18536N) .

Synonyms

SPRTN; C1orf124; DVC1; PRO4323; spartan

Gene ID

83932

UniProt

Q9H040

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/29kDa/55kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=83932

Uniprot URL

https://www.uniprot.org/uniprot/Q9H040

AA Sequence

MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM29 (NM_014269) Human Tagged Lenti ORF Clone
RC214250L2 10 µg

ADAM29 (NM_014269) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
s-100 Antibody (IHC Gold)
MBS8580168-01 0.1 mL

s-100 Antibody (IHC Gold)

Sign In for Pricing
View Details
s-100 Antibody (IHC Gold)
MBS8580168-02 0.1 mL (AF635)

s-100 Antibody (IHC Gold)

Sign In for Pricing
View Details
s-100 Antibody (IHC Gold)
MBS8580168-03 0.1 mL (AF610)

s-100 Antibody (IHC Gold)

Sign In for Pricing
View Details
s-100 Antibody (IHC Gold)
MBS8580168-04 0.1 mL (AF405S)

s-100 Antibody (IHC Gold)

Sign In for Pricing
View Details
s-100 Antibody (IHC Gold)
MBS8580168-05 0.1 mL (AF405L)

s-100 Antibody (IHC Gold)

Sign In for Pricing
View Details