Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DQB2 Rabbit pAb (APR18522N)

Product Specifications

Background

HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. Because there is evidence of transcription and an intact ORF, HLA-DQB2 is represented in Entrez Gene and in RefSeq as a protein-coding locus.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-DQB2 Rabbit pAb (APR18517N5) .

Synonyms

HLA-DQB2; HLA-DQB1; HLA-DXB; major histocompatibility complex; class II; DQ beta 2

Gene ID

3120

UniProt

P05538

Cellular Locus

Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/30kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3120

Uniprot URL

https://www.uniprot.org/uniprot/P05538

AA Sequence

ARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human AMDHD2 shRNA Plasmid
abx959447-01 150 µg

Human AMDHD2 shRNA Plasmid

Ask
View Details
Human AMDHD2 shRNA Plasmid
abx959447-02 300 µg

Human AMDHD2 shRNA Plasmid

Ask
View Details
Rat Nrk Pre-designed siRNA Set A
SI209546A 1 Each

Rat Nrk Pre-designed siRNA Set A

Ask
View Details
Mouse Monoclonal TM4SF4 Antibody (832441) [Alexa Fluor 532]
FAB7998X 0.1 mL

Mouse Monoclonal TM4SF4 Antibody (832441) [Alexa Fluor 532]

Ask
View Details
KNG1 Antibody
E30AC1790 100 µL

KNG1 Antibody

Ask
View Details
ALOX15 (Arachidonate 15-lipoxygenase, 15-LOX, Arachidonate omega-6 Lipoxygenase, LOG15) discontinued
A1359-80D 50 µg

ALOX15 (Arachidonate 15-lipoxygenase, 15-LOX, Arachidonate omega-6 Lipoxygenase, LOG15) discontinued

Ask
View Details