Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Destrin Rabbit pAb (APR18520N)

Product Specifications

Background

The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin) . Two transcript variants encoding distinct isoforms have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Destrin Rabbit pAb (APR18517N3) .

Synonyms

DSTN; ACTDP; ADF; HEL32; bA462D18.2; destrin

Gene ID

11034

UniProt

P60981

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/18kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11034

Uniprot URL

https://www.uniprot.org/uniprot/P60981

AA Sequence

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP-1 Polyclonal Antibody, Cy5 Conjugated
bs-4600R-Cy5 100 µL

TIMP-1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ZAP70 [p Tyr319] Antibody [Alexa Fluor 700]
NBP1-18896AF700 0.1 mL

Rabbit Polyclonal ZAP70 [p Tyr319] Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
PPIL1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-14651 0.1 mg

PPIL1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Aldosterone (ALD) ELISA Kit
YP-W72210-01 48 Tests

Rabbit Aldosterone (ALD) ELISA Kit

Sign In for Pricing
View Details
Rabbit Aldosterone (ALD) ELISA Kit
YP-W72210-02 96 Tests

Rabbit Aldosterone (ALD) ELISA Kit

Sign In for Pricing
View Details
Rat Inducible nitric oxide synthase ELISA Kit
MBS723326-01 48 Well

Rat Inducible nitric oxide synthase ELISA Kit

Sign In for Pricing
View Details