Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR3 Rabbit pAb (APR18518N)

Product Specifications

Background

This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant) . Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CXCR3 Rabbit pAb (APR18517N1) .

Synonyms

CXCR3; CD182; CD183; CKR-L2; CMKAR3; GPR9; IP10-R; Mig-R; MigR

Gene ID

2833

UniProt

P49682

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/40kDa/45kDa Observed MW: 46KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2833

Uniprot URL

https://www.uniprot.org/uniprot/P49682

AA Sequence

NCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZBTB4, ID (ZBTB4, KIAA1538, Zinc finger and BTB domain-containing protein 4, KAISO-like zinc finger protein 1) (APC)
MBS6364634-01 0.2 mL

ZBTB4, ID (ZBTB4, KIAA1538, Zinc finger and BTB domain-containing protein 4, KAISO-like zinc finger protein 1) (APC)

Ask
View Details
ZBTB4, ID (ZBTB4, KIAA1538, Zinc finger and BTB domain-containing protein 4, KAISO-like zinc finger protein 1) (APC)
MBS6364634-02 5x 0.2 mL

ZBTB4, ID (ZBTB4, KIAA1538, Zinc finger and BTB domain-containing protein 4, KAISO-like zinc finger protein 1) (APC)

Ask
View Details
ZFYVE28 CRISPRa sgRNA lentivector (set of three targets)(Rat)
51233126 3x 1.0µg DNA

ZFYVE28 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
UBP46, CT (USP46, Ubiquitin carboxyl-terminal hydrolase 46, Deubiquitinating enzyme 46, Ubiquitin thioesterase 46, Ubiquitin-specific-processing protease 46) (MaxLight 405)
MBS6360964-01 0.1 mL

UBP46, CT (USP46, Ubiquitin carboxyl-terminal hydrolase 46, Deubiquitinating enzyme 46, Ubiquitin thioesterase 46, Ubiquitin-specific-processing protease 46) (MaxLight 405)

Ask
View Details
UBP46, CT (USP46, Ubiquitin carboxyl-terminal hydrolase 46, Deubiquitinating enzyme 46, Ubiquitin thioesterase 46, Ubiquitin-specific-processing protease 46) (MaxLight 405)
MBS6360964-02 5x 0.1 mL

UBP46, CT (USP46, Ubiquitin carboxyl-terminal hydrolase 46, Deubiquitinating enzyme 46, Ubiquitin thioesterase 46, Ubiquitin-specific-processing protease 46) (MaxLight 405)

Ask
View Details
Neurofilament 3 (NEF3) Human ELISA Kit
F3294 96 Tests

Neurofilament 3 (NEF3) Human ELISA Kit

Ask
View Details