Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN1 Rabbit pAb (APR18517N)

Product Specifications

Background

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACTN1 Rabbit pAb (APR18517N) .

Synonyms

ACTN1; BDPLT15

Gene ID

87

UniProt

P12814

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Z line, cytoskeleton, myofibril, ruffle, sarcomere

Applications

WB (Mus musculus, Danio rerio) IF (Homo sapiens) ICC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 102kDa/103kDa/105kDa/107kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=87

Uniprot URL

https://www.uniprot.org/uniprot/P12814

AA Sequence

MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Gentain Violet powder
3122505 1 Each

Gentain Violet powder

Ask
View Details
EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind
MBS6475324-01 0.1 mL

EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind

Ask
View Details
EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind
MBS6475324-02 5x 0.1 mL

EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind

Ask
View Details
P27Kip1, phosphorylated (T170) (CDKN1B, KIP1, Cyclin-dependent kinase inhibitor 1B, Cyclin-dependent kinase inhibitor p27, p27Kip1) (Azide free) (HRP) discontinued
039572-HRP 200 µL

P27Kip1, phosphorylated (T170) (CDKN1B, KIP1, Cyclin-dependent kinase inhibitor 1B, Cyclin-dependent kinase inhibitor p27, p27Kip1) (Azide free) (HRP) discontinued

Ask
View Details
pLV2-U6-GLO1-shRNA2-PGK-Puro Plasmid
PVT46097 2 µg

pLV2-U6-GLO1-shRNA2-PGK-Puro Plasmid

Ask
View Details
Canine Complement 5 a (C5a) ELISA Kit
NSL0026Ca 96 Tests

Canine Complement 5 a (C5a) ELISA Kit

Ask
View Details