Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM Rabbit pAb (APR18510N)

Product Specifications

Background

The protein encoded by this gene is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. The encoded protein acts as a homodimer and is involved in cell motility and cell-matrix interactions. The expression of this gene is downregulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HEPACAM Rabbit pAb (APR18504N9) .

Synonyms

HEPACAM; GlialCAM; MLC2A; MLC2B

Gene ID

220296

UniProt

Q14CZ8

Cellular Locus

Cytoplasm, Cytoplasmic side, Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/46kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=220296

Uniprot URL

https://www.uniprot.org/uniprot/Q14CZ8

AA Sequence

NITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSSLYIIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli yahC Protein (aa 1-165)
VAng-Lsx02712-inquire Inquire

Recombinant Escherichia coli yahC Protein (aa 1-165)

Sign In for Pricing
View Details
Mouse Usp20 qPCR Primer Pair
QM42918S 200 Tests

Mouse Usp20 qPCR Primer Pair

Sign In for Pricing
View Details
Clpb Lentiviral Activation Particles (m2)
sc-422963-LAC-2 200 µL

Clpb Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
CD152 (CD152 Antigen, Celiac Disease 3, CELIAC3, Cytotoxic T cell associated 4, Cytotoxic T-lymphocyte-associated Antigen 4, CTLA 4, CTLA4, CTLA-4, Cytotoxic T-lymphocyte-associated Protein 4, Cytotoxic T-lymphocyte-associated Serine Esterase 4, Cytotoxic
MBS6253434-01 0.1 mL

CD152 (CD152 Antigen, Celiac Disease 3, CELIAC3, Cytotoxic T cell associated 4, Cytotoxic T-lymphocyte-associated Antigen 4, CTLA 4, CTLA4, CTLA-4, Cytotoxic T-lymphocyte-associated Protein 4, Cytotoxic T-lymphocyte-associated Serine Esterase 4, Cytotoxic

Sign In for Pricing
View Details
CD152 (CD152 Antigen, Celiac Disease 3, CELIAC3, Cytotoxic T cell associated 4, Cytotoxic T-lymphocyte-associated Antigen 4, CTLA 4, CTLA4, CTLA-4, Cytotoxic T-lymphocyte-associated Protein 4, Cytotoxic T-lymphocyte-associated Serine Esterase 4, Cytotoxic
MBS6253434-02 5x 0.1 mL

CD152 (CD152 Antigen, Celiac Disease 3, CELIAC3, Cytotoxic T cell associated 4, Cytotoxic T-lymphocyte-associated Antigen 4, CTLA 4, CTLA4, CTLA-4, Cytotoxic T-lymphocyte-associated Protein 4, Cytotoxic T-lymphocyte-associated Serine Esterase 4, Cytotoxic

Sign In for Pricing
View Details
Tor2a (NM_152800) Mouse Tagged ORF Clone Lentiviral Particle
MR204635L4V 200 µL

Tor2a (NM_152800) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details