Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL3 Rabbit pAb (APR18505N)

Product Specifications

Background

This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BCL3 Rabbit pAb (APR18504N2) .

Synonyms

BCL3; BCL4; D19S37

Gene ID

602

UniProt

P20749

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=602

Uniprot URL

https://www.uniprot.org/uniprot/P20749

AA Sequence

ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM18 activation kit by CRISPRa
GA115091 1 Kit

Human TMEM18 activation kit by CRISPRa

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF405S conjugate, 0.1mg/mL
BNC043134-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alpha A Crystallin Antibody (Biotin)
KB-7870-01 50 μL

Alpha A Crystallin Antibody (Biotin)

Sign In for Pricing
View Details
Alpha A Crystallin Antibody (Biotin)
KB-7870-02 100 µL

Alpha A Crystallin Antibody (Biotin)

Sign In for Pricing
View Details
Alpha A Crystallin Antibody (Biotin)
KB-7870-03 1 mL

Alpha A Crystallin Antibody (Biotin)

Sign In for Pricing
View Details
SNX30 (NM_001012994) Human Over-expression Lysate
LC422952 20 µg

SNX30 (NM_001012994) Human Over-expression Lysate

Sign In for Pricing
View Details