Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PI3 Kinase p85 alpha Rabbit pAb (APR18486N)

Product Specifications

Background

Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PI3 Kinase p85 alpha Rabbit pAb (APR18486N) .

Synonyms

AGM7; GRB1; IMD36; p85; p85-ALPHA; PI3 Kinase p85 alpha; PIK3R1

Gene ID

5295

UniProt

P27986

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa/49kDa/53kDa/83kDa/84kDa Observed MW: 85KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5295

Uniprot URL

https://www.uniprot.org/uniprot/P27986

AA Sequence

EKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr653 (NM_147074) Mouse Tagged ORF Clone Lentiviral Particle
MR213858L3V 200 µL

Olfr653 (NM_147074) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Transglutaminase-1 Rabbit pAb
E47R6690 100 µL

Transglutaminase-1 Rabbit pAb

Sign In for Pricing
View Details
Rat connective tissue growth factor, CTGF ELISA KIT
E0356Ra-01 48 Well

Rat connective tissue growth factor, CTGF ELISA KIT

Sign In for Pricing
View Details
Rat connective tissue growth factor, CTGF ELISA KIT
E0356Ra-02 96 Well

Rat connective tissue growth factor, CTGF ELISA KIT

Sign In for Pricing
View Details
Rat connective tissue growth factor, CTGF ELISA KIT
E0356Ra-03 5x 96 Tests

Rat connective tissue growth factor, CTGF ELISA KIT

Sign In for Pricing
View Details
Rat connective tissue growth factor, CTGF ELISA KIT
E0356Ra-04 10x 96 Tests

Rat connective tissue growth factor, CTGF ELISA KIT

Sign In for Pricing
View Details