Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E-Cadherin Rabbit pAb (APR18479N)

Product Specifications

Background

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality E-Cadherin Rabbit pAb (APR18479N) .

Synonyms

Arc-1; CD324; CDHE; ECAD; LCAM; UVO; CDH1; E-Cadherin

Gene ID

999

UniProt

P12830

Cellular Locus

Cell junction, Cell membrane, Endosome, Golgi apparatus, Single-pass type I membrane protein, trans-Golgi network

Applications

WB (Homo sapiens) IF (Homo sapiens) IHC (Homo sapiens)

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 90kDa/97kDa Observed MW: 130kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=999

Uniprot URL

https://www.uniprot.org/uniprot/P12830

AA Sequence

PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Angoroside C
MBS579842 Inquire

Angoroside C

Ask
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit
MBS7235024-01 48 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit

Ask
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit
MBS7235024-02 96 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit

Ask
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit
MBS7235024-03 5x 96 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit

Ask
View Details
Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit
MBS7235024-04 10x 96 Well

Porcine Mitochondrial import inner membrane translocase subunit Tim22 (TIMM22) ELISA Kit

Ask
View Details
Lrif1 (NM_001127485) Rat Tagged Lenti ORF Clone
RR208879L3 10 µg

Lrif1 (NM_001127485) Rat Tagged Lenti ORF Clone

Ask
View Details