Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF5 Rabbit pAb (APR18473N)

Product Specifications

Background

This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IRF5 Rabbit pAb (APR18473N) .

Synonyms

IRF5; SLEB10

Gene ID

3663

UniProt

Q13568

Cellular Locus

Cytoplasm, Nucleus

Applications

IHC (Rattus norvegicus) WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/47kDa/54kDa/56kDa/57kDa Observed MW: 56kDa/60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3663

Uniprot URL

https://www.uniprot.org/uniprot/Q13568

AA Sequence

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAG-3 Antibody / Lymphocyte activation gene 3 protein / CD223
FY12697 100 µL

LAG-3 Antibody / Lymphocyte activation gene 3 protein / CD223

Sign In for Pricing
View Details
EphB2 Receptor (Ephrin B2 Receptor) (MaxLight 650)
MBS6259852-01 0.1 mL

EphB2 Receptor (Ephrin B2 Receptor) (MaxLight 650)

Sign In for Pricing
View Details
EphB2 Receptor (Ephrin B2 Receptor) (MaxLight 650)
MBS6259852-02 5x 0.1 mL

EphB2 Receptor (Ephrin B2 Receptor) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal Myosin heavy chain 11 Antibody (SPM201) [Janelia Fluor 646]
NBP3-11585JF646 0.1 mL

Mouse Monoclonal Myosin heavy chain 11 Antibody (SPM201) [Janelia Fluor 646]

Sign In for Pricing
View Details
Alcian Blue 8GX (1% in 0.1N HCl) pH 1.0
RRSP193-D 500 mL

Alcian Blue 8GX (1% in 0.1N HCl) pH 1.0

Sign In for Pricing
View Details
FASP1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-9738R-PE-Cy7 100 µL

FASP1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details