Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF4 Rabbit pAb (APR18446N)

Product Specifications

Background

This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. In addition, an intronic CTG repeat normally numbering 10-37 repeat units can expand to >50 repeat units and cause Fuchs endothelial corneal dystrophy. Multiple alternatively spliced transcript variants that encode different proteins have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCF4 Rabbit pAb (APR18446N) .

Synonyms

TCF4; E2-2; FECD3; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4; bHLHb19; TCF4

Gene ID

6925

UniProt

P15884

Cellular Locus

Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48-71kDa Observed MW: 71KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6925

Uniprot URL

https://www.uniprot.org/uniprot/P15884

AA Sequence

LRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Cadherin-6/KCAD Antibody (09) [Alexa Fluor 700]
NBP3-12779AF700 100 µL

Mouse Monoclonal Cadherin-6/KCAD Antibody (09) [Alexa Fluor 700]

Ask
View Details
RPL10L (NM_080746) Human Tagged Lenti ORF Clone
RC204751L3 10 µg

RPL10L (NM_080746) Human Tagged Lenti ORF Clone

Ask
View Details
SMS (Spermine Synthase, SPMSY, Spermidine Aminopropyltransferase) (MaxLight 750) discontinued
133585-ML750 100 µL

SMS (Spermine Synthase, SPMSY, Spermidine Aminopropyltransferase) (MaxLight 750) discontinued

Ask
View Details
SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (Azide free) (HRP)
MBS6348257-01 0.2 mL

SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (Azide free) (HRP)

Ask
View Details
SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (Azide free) (HRP)
MBS6348257-02 5x 0.2 mL

SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (Azide free) (HRP)

Ask
View Details